PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009599539.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 305aa    MW: 34165.9 Da    PI: 7.8627
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009599539.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.12.6e-32173229158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     dep++VNaKQyq+Il+RR+ Rakle+++kl +k+rkpylheSRh+hAl+R+Rg+gGrF
  XP_009599539.1 173 DEPIFVNAKQYQAILRRREYRAKLEAQNKL-SKGRKPYLHESRHRHALNRARGPGGRF 229
                     79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.2E-34171232IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.699172232IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.1E-27174229IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.3E-22175197IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860177197IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.3E-22206229IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0009785Biological Processblue light signaling pathway
GO:0010262Biological Processsomatic embryogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MISRMQDLLQ KGSDLSSVST GPSISVRPSW WTSKEPQMQQ WLTFPGPQNP EQFGFHFQDQ  60
DSSSTQSTGQ SCPEVATEGE SKIYGKSNMP FQAGYSKSIE KPDEAQSEST LSSHEHDCTY  120
QGNHKQIAYA PFAYSDPYCH GLLASYGQCS SVYPQMLGPI SARVPLPLDY QQDEPIFVNA  180
KQYQAILRRR EYRAKLEAQN KLSKGRKPYL HESRHRHALN RARGPGGRFL NMKKLLESGS  240
PDVTNVQGTP VSNALQLNRQ IMEPKVHQSK NFQESYSTPT CSGISNGSNC DDIDQQQPLN  300
YSAFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-20173245271NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009599539.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like
RefseqXP_016441195.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like
SwissprotQ9SYH41e-46NFYA5_ARATH; Nuclear transcription factor Y subunit A-5
TrEMBLM0ZR711e-100M0ZR71_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000063581e-99(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA139661114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.12e-43nuclear factor Y, subunit A5